PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10010055
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 308aa    MW: 33279.7 Da    PI: 7.3719
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10010055genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.6e-181156147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l ++v+ +G+++W++I++ ++ gR++k+c++rw + 
      Lus10010055 11 KGPWSPEEDEALQRLVQTYGPRDWTLISKSIP-GRSGKSCRLRWCNQ 56
                     79******************************.***********985 PP

2Myb_DNA-binding59.38.5e-1965107347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+++++a++++G++ W+tIar ++ gRt++++k++w++ 
      Lus10010055  65 PFTPEEDDIIIKAHARFGNK-WATIARLLN-GRTDNSIKNHWNST 107
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.54657IPR017930Myb domain
SuperFamilySSF466891.72E-328104IPR009057Homeodomain-like
SMARTSM007174.2E-171059IPR001005SANT/Myb domain
PfamPF002495.3E-181156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-261264IPR009057Homeodomain-like
CDDcd001672.88E-161355No hitNo description
PROSITE profilePS5129425.68558112IPR017930Myb domain
SMARTSM007174.7E-1662110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2465111IPR009057Homeodomain-like
CDDcd001673.87E-1365108No hitNo description
PfamPF002493.1E-1665107IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MAASNQTDRI KGPWSPEEDE ALQRLVQTYG PRDWTLISKS IPGRSGKSCR LRWCNQLSPE  60
VEHRPFTPEE DDIIIKAHAR FGNKWATIAR LLNGRTDNSI KNHWNSTLKR KCDGTTSLAE  120
QPPLKRSASL GAGSNFSGLY LHPSSPSGSD LSDSSLYGND CSSLVYYPLA RTASLIPPTL  180
SMDVSSSIRD PLTSLSLSFS GSDLPETLDA GSALGSCALP AALVVASPPN AVTVEQQAPI  240
LQEKAEVGLE KQMFNPEFLG VMQEMIRKEV RSYMSGIEKK GMCFQAEAIR NAVVRELGLP  300
GPGSSKA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-42101123105MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-42101123105C-Myb DNA-Binding Domain
1msf_C4e-42101123105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8298651e-156EU829865.1 Linum usitatissimum clone LU0013B04 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302428.21e-139hypothetical protein POPTR_0002s12410g, partial
SwissprotQ9FDW15e-84MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A067KZQ61e-140A0A067KZQ6_JATCU; MYB family protein
STRINGPOPTR_0002s12410.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.15e-78myb domain protein 73